Proteintech, 21533-1-AP, IQCC Polyclonal antibody

Size: 20ul / 150ul The IQCC (21533-1-AP) by Proteintech is a Polyclonal antibody targeting IQCC in WB, ELISA applications with reactivity to human samples 21533-1-AP targets IQCC in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16161 Product name: Recombinant human IQCC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-466 aa of BC098317 Sequence: CRDHSSWLQMKQNRKPSQEKTRDTTRMENPEATDQRLPHSQPQLQELQYHRSHLAMELLWLQQAINSRKEYLLLKQTLRSPEAGPIREEPRVFLEHGEQACERDQSQPSAPLEDQSYRDRTTGELEQEDDSCHRVKSPHRSPGSLATTQKNIAGAKCREPCYSKSGPPSSIPSNSQALGDRLTKGPDDGRQTFGGTCLLQMKILEDQTPRGLKPRNHCPRKSRTQLSALYEDSNIKEMSPRKLDHKEPDCRTVRTQELGLSEDHIIWDGTLGGPEHSVLDLWRTKPPKGQAPTDRSSRDGTSNEPSHEGQKKQRTIPWRSKSPEILSSTKAGCTGEEQWRGRPWKTEPPG Predict reactive species Full Name: IQ motif containing C Calculated Molecular Weight: 466 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC098317 Gene Symbol: IQCC Gene ID (NCBI): 55721 RRID: AB_3085660 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4KMZ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.