Iright
BRAND / VENDOR: Proteintech

Proteintech, 21541-1-AP, FCGR2B / CD32b Polyclonal antibody

CATALOG NUMBER: 21541-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FCGR2B / CD32b (21541-1-AP) by Proteintech is a Polyclonal antibody targeting FCGR2B / CD32b in WB, IHC, ELISA applications with reactivity to human samples 21541-1-AP targets FCGR2B / CD32b in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, Raji cells Positive IHC detected in: human tonsillitis tissue, human placenta tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16189 Product name: Recombinant human FCGR2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-310 aa of BC031992 Sequence: ALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI Predict reactive species Full Name: Fc fragment of IgG, low affinity IIb, receptor (CD32) Calculated Molecular Weight: 310 aa, 34 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC031992 Gene Symbol: CD32b Gene ID (NCBI): 2213 RRID: AB_2878881 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31994 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924