Proteintech, 21544-1-AP, ZEB1 Polyclonal antibody

Size: 20ul / 150ul The ZEB1 (21544-1-AP) by Proteintech is a Polyclonal antibody targeting ZEB1 in WB, IP, ELISA applications with reactivity to human, mouse samples 21544-1-AP targets ZEB1 in WB, IHC, IF, IP, CoIP, chIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, MCF-7 cells, PC-3 cells, COLO 320 cells, MDA-MB-453s cells, mouse colon tissue Positive IP detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ZEB1(zinc-finger-enhancer binding protein 1), which is a member of the Zinc finger-Homeobox (ZFH) family of repressors, acts as a transcriptional repressor that inhibits interleukin-2 (IL-2) gene expression. Depending on the quantity of cDNA and on the cell type, ZEB1 can enhance or repress the promoter activity of the ATP1A1 gene. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. The calculated molecular weight of ZEB1 is 124 kDa, but the post-phosphorylation of protein is about 190-210 kDa. This is a rabbit polyclonal antibody raised against part of the full length of ZEB1 of human. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16204 Product name: Recombinant human ZEB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 391-740 aa of BC112392 Sequence: MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSL Predict reactive species Full Name: zinc finger E-box binding homeobox 1 Calculated Molecular Weight: 1125 aa, 124 kDa Observed Molecular Weight: 190-210 kDa GenBank Accession Number: BC112392 Gene Symbol: ZEB1 Gene ID (NCBI): 6935 RRID: AB_10734325 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P37275 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.