Proteintech, 21565-1-AP, ATP8A1 Polyclonal antibody

Size: 20ul / 150ul The ATP8A1 (21565-1-AP) by Proteintech is a Polyclonal antibody targeting ATP8A1 in WB, ELISA applications with reactivity to human, mouse, rat samples 21565-1-AP targets ATP8A1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16071 Product name: Recombinant human ATP8A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-527 aa of BC109317 Sequence: QNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLN Predict reactive species Full Name: ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 Calculated Molecular Weight: 1164 aa, 131 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC109317 Gene Symbol: ATP8A1 Gene ID (NCBI): 10396 RRID: AB_10734587 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2Q0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.