Iright
BRAND / VENDOR: Proteintech

Proteintech, 21566-1-AP, NAGS Polyclonal antibody

CATALOG NUMBER: 21566-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NAGS (21566-1-AP) by Proteintech is a Polyclonal antibody targeting NAGS in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21566-1-AP targets NAGS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, Jurkat cells, HepG2 cells, L02 cells, rat liver tissue Positive IHC detected in: human liver tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information N-acetylglutamate synthase, also known as NAGS, is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAGS is the key enzyme for regulating the hepatic urea cycle and is also highly expressed in the kidney and gut. Deficiency of NAGS leads to hyperammonemia due to decreased activity of CPSI deprived of its cofactor NAG(PMID:12459178,12754705). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16073 Product name: Recombinant human NAGS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-368 aa of BC111713 Sequence: MDMKPLVVLGLPAPTAPSGCLSFWEAKAQLAKSCKVLVDALRHNAAAAVPFFGGGSVLRAAEPAPHASYGGIVSVETDLLQWCLESGSIPILCPIGETAARRSVLLDSLEVTASLAKALRPTKIIFLNNTGGLRDSSHKVLSNVNLPADLDLVCNAEWVSTKERQQMRLIVDVLSRLPHHSSAVITAASTLLTELFSNKGSGTLFKNAERMLRVRSLDKLDQGRLVDLVNASFGKKLRDDYLASLRPRLHSIYVSEGYNAAAILTMEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDPGS Predict reactive species Full Name: N-acetylglutamate synthase Calculated Molecular Weight: 534 aa, 58 kDa Observed Molecular Weight: 58-66 kDa GenBank Accession Number: BC111713 Gene Symbol: NAGS Gene ID (NCBI): 162417 RRID: AB_10733886 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N159 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924