Iright
BRAND / VENDOR: Proteintech

Proteintech, 21581-1-AP, BTK Polyclonal antibody

CATALOG NUMBER: 21581-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BTK (21581-1-AP) by Proteintech is a Polyclonal antibody targeting BTK in WB, IP, ELISA applications with reactivity to human, mouse samples 21581-1-AP targets BTK in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Daudi cells, Ramos cells, HT-29 cells, NIH/3T3 cells Positive IP detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16133 Product name: Recombinant human BTK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-184 aa of BC109079 Sequence: RLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKT Predict reactive species Full Name: Bruton agammaglobulinemia tyrosine kinase Calculated Molecular Weight: 659 aa, 76 kDa Observed Molecular Weight: 70-76 kDa GenBank Accession Number: BC109079 Gene Symbol: BTK Gene ID (NCBI): 695 RRID: AB_10734434 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06187 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924