Proteintech, 21582-1-AP, CYP24A1 Polyclonal antibody

Size: 20ul / 150ul The CYP24A1 (21582-1-AP) by Proteintech is a Polyclonal antibody targeting CYP24A1 in WB, IHC, IP, ELISA applications with reactivity to human samples 21582-1-AP targets CYP24A1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human kidney tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information CYP24A1(1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial) catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D3) and 1-alpha,25-dihydroxyvitamin D3. Cholecalciferol is metabolised by the 25-hydroxylases (CYP2R1 and CYP27A1) in the liver, before 25-hydroxycholecalciferol (25(OH)D3) relocates to the circulation (PMID:20362668). The gene CYP24A1 has three isoforms, for the transit peptide "mitochondrial domain" removed, the MW of CYP24A1 will be 55-59 kDa, 47-51 kDa and 43 kDa. This antibody is specific to CYP24A1. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16134 Product name: Recombinant human CYP24A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC109083 Sequence: MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQ Predict reactive species Full Name: cytochrome P450, family 24, subfamily A, polypeptide 1 Calculated Molecular Weight: 514 aa, 59 kDa Observed Molecular Weight: 54-59 kDa GenBank Accession Number: BC109083 Gene Symbol: CYP24A1 Gene ID (NCBI): 1591 RRID: AB_10792804 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07973 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.