Iright
BRAND / VENDOR: Proteintech

Proteintech, 21595-1-AP, PTGFR Polyclonal antibody

CATALOG NUMBER: 21595-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTGFR (21595-1-AP) by Proteintech is a Polyclonal antibody targeting PTGFR in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21595-1-AP targets PTGFR in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Prostanoid FP receptor(PTGFR) is a member of the G-protein coupled receptor family and is involved in several physiologic processes. PTGFR is a receptor for prostaglandin F2-alpha (PGF2-alpha), which is known to be a potent luteolytic agent, and may also be involved in modulating intraocular pressure and smooth muscle contraction in the uterus(PMID: 9235889). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16173 Product name: Recombinant human PTGFR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 305-359 aa of BC112965 Sequence: ILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST Predict reactive species Full Name: prostaglandin F receptor (FP) Calculated Molecular Weight: 359 aa, 40 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC112965 Gene Symbol: PTGFR Gene ID (NCBI): 5737 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43088 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924