Iright
BRAND / VENDOR: Proteintech

Proteintech, 21600-1-AP, TTC7A Polyclonal antibody

CATALOG NUMBER: 21600-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TTC7A (21600-1-AP) by Proteintech is a Polyclonal antibody targeting TTC7A in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 21600-1-AP targets TTC7A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SW480 cells, K-562 cells, mouse colon tissue, mouse small intestine tissue, PC-3 cells, mouse thymus tissue Positive IP detected in: K-562 cells Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TTC7A (TPR repeat protein 7A) is expressed in enterocytes within the duodenum, ileum, and colon, and has a role in enterocyte survival and function. Mutations in the TTC7A gene can result in a spectrum of intestinal disease, including multiple intestinal atresia (MIA) and very early onset inflammatory bowel diseases (VEOIBD). Functional analysis revealed that TTC7A binds to and facilitates the transport of PI4KIIIa from the trans-Golgi to the plasma membrane, while loss of TTC7A results in dysregulation of PI4KIIIa signaling. This antibody specially recognizes endogenous TTC7A. (24417819) Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16212 Product name: Recombinant human TTC7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 149-465 aa of BC114365 Sequence: DATLKSKQDELHRKALQTLERAQQLAPSDPQVILYVSLQLALVRQISSAMEQLQEALKVRKDDAHALHLLALLFSAQKHHQHALDVVNMAITEHPGNFNLMFTKVKLEQVLKGPEEALVTCRQVLRLWQTLYSFSQLGGLEKDGSFGEGLTMKKQSGMHLTLPDAHDADSGSRRASSIAASRLEEAMSELTMPSSVLKQGPMQLWTTLEQIWLQAAELFMEQQHLKEAGFCIQEAAGLFPTSHSVLYMRGRLAEVKGNLEEAKQLYKEALTVNPDGVRIMHSLGLMLSRLGHKSLAQKVLRDAVERQSTCHEAWQGL Predict reactive species Full Name: tetratricopeptide repeat domain 7A Calculated Molecular Weight: 858 aa, 96 kDa Observed Molecular Weight: 96 kDa GenBank Accession Number: BC114365 Gene Symbol: TTC7A Gene ID (NCBI): 57217 RRID: AB_10733221 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULT0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924