Proteintech, 21602-1-AP, ALDH8A1 Polyclonal antibody

Size: 20ul / 150ul The ALDH8A1 (21602-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH8A1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21602-1-AP targets ALDH8A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, mouse kidney tissue, mouse liver tissue, rat liver tissue Positive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16214 Product name: Recombinant human ALDH8A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-487 aa of BC113862 Sequence: CMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIYSEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITVKH Predict reactive species Full Name: aldehyde dehydrogenase 8 family, member A1 Calculated Molecular Weight: 487 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC113862 Gene Symbol: ALDH8A1 Gene ID (NCBI): 64577 RRID: AB_10733887 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2A2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.