Proteintech, 21608-1-AP, NRCAM Polyclonal antibody

Size: 20ul / 150ul The NRCAM (21608-1-AP) by Proteintech is a Polyclonal antibody targeting NRCAM in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21608-1-AP targets NRCAM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, HEK-293 cells, rat brain tissue Positive IHC detected in: mouse brain tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Neuronal cell adhesion molecule (NRCAM) is a member of the L1 subfamily of cell adhesion molecules (CAMs) that belong to the immunoglobulin superfamily (PMID: 11329126). NRCAM is a transmembrane protein composed of six Ig-like domains and five fibronectin type-III repeats in the extracellular region, with a highly conserved cytoplasmic tail. It is mainly expressed in the nervous system and is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM is also expressed outside the nervous system. Altered expression of NRCAM has been associated with tumor progression in diverse organs (PMID: 22182708). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16237 Product name: Recombinant human NRCAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 446-628 aa of BC098401 Sequence: EPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDATWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAVLSVV Predict reactive species Full Name: neuronal cell adhesion molecule Calculated Molecular Weight: 1304 aa, 144 kDa Observed Molecular Weight: 130-136 kDa GenBank Accession Number: BC098401 Gene Symbol: NRCAM Gene ID (NCBI): 4897 RRID: AB_10859786 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92823 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.