Proteintech, 21627-1-AP, ZDHHC15 Polyclonal antibody

Size: 20ul / 150ul The ZDHHC15 (21627-1-AP) by Proteintech is a Polyclonal antibody targeting ZDHHC15 in WB, ELISA applications with reactivity to human samples 21627-1-AP targets ZDHHC15 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, SMMC-7721 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16152 Product name: Recombinant human ZDHHC15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-337 aa of BC103982 Sequence: VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET Predict reactive species Full Name: zinc finger, DHHC-type containing 15 Calculated Molecular Weight: 337 aa, 39 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC103982 Gene Symbol: ZDHHC15 Gene ID (NCBI): 158866 RRID: AB_2878892 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.