Product Description
Size: 20ul / 150ul
The oncomodulin (21650-1-AP) by Proteintech is a Polyclonal antibody targeting oncomodulin in IHC, ELISA applications with reactivity to human samples
21650-1-AP targets oncomodulin in IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
Oncomodulin (OCM) is a small EF-hand Ca2+-binding protein (CaBP) of approximately 12 kDa belonging to the parvalbumin family. Oncomodulin (OCM) consists of two active Ca2+-specific domains of the EF-hand type ("helix-loop-helix" motif), covered by an EF-hand domain with inactive EF-hand loop, which contains a highly conservative cysteine with unknown function.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16358 Product name: Recombinant human OCM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC113706 Sequence: MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS Predict reactive species
Full Name: oncomodulin
Calculated Molecular Weight: 109 aa, 12 kDa
GenBank Accession Number: BC113706
Gene Symbol: Oncomodulin
Gene ID (NCBI): 654231
RRID: AB_3669371
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P0CE72
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924