Proteintech, 21659-1-AP, KCNA5 Polyclonal antibody

Size: 20ul / 150ul The KCNA5 (21659-1-AP) by Proteintech is a Polyclonal antibody targeting KCNA5 in WB, ELISA applications with reactivity to human, mouse, rat samples 21659-1-AP targets KCNA5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: 37°C incubated mouse brain tissue, unboiled mouse brain tissue, rat brain tissue, unboiled rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16397 Product name: Recombinant human KCNA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC099665 Sequence: MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDADSGVRPLPPLPDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQRVH Predict reactive species Full Name: potassium voltage-gated channel, shaker-related subfamily, member 5 Calculated Molecular Weight: 613 aa, 67 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC099665 Gene Symbol: KCNA5 Gene ID (NCBI): 3741 RRID: AB_2878902 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22460 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.