Proteintech, 21662-1-AP, ATP5G3 Polyclonal antibody

Size: 20ul / 150ul The ATP5G3 (21662-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5G3 in IHC, ELISA applications with reactivity to human samples 21662-1-AP targets ATP5G3 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ATP5G3, also known as ATP5MC3, belongs to the ATPase C chain family. ATP5G3 encodes subunit 9 (ATPase subunit c), which is a subunit of the multi-subunit enzyme that catalyzes ATP synthesis during oxidative phosphorylation in mitochondria. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The subunit c is a component of the proton channel proteins in the F0 portion of the enzyme. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16406 Product name: Recombinant human ATP5G3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC106881 Sequence: MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREF Predict reactive species Full Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) Calculated Molecular Weight: 142 aa, 15 kDa GenBank Accession Number: BC106881 Gene Symbol: ATP5G3 Gene ID (NCBI): 518 RRID: AB_3085665 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48201 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.