Proteintech, 21673-1-AP, KRTAP3-1 Polyclonal antibody

Size: 20ul / 150ul The KRTAP3-1 (21673-1-AP) by Proteintech is a Polyclonal antibody targeting KRTAP3-1 in WB, ELISA applications with reactivity to human, mouse, rat samples 21673-1-AP targets KRTAP3-1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skin tissue, rat skin tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information KRTAP3-1 is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16508 Product name: Recombinant human KRTAP3-1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-98 aa of BC113077 Sequence: PHEISLLQPICCDTCPPPCCKPDTYVPTCWLLNNCHPTPGLSGINLTTYVQPGCESPCEPRC Predict reactive species Full Name: keratin associated protein 3-1 Calculated Molecular Weight: 98 aa, 11 kDa Observed Molecular Weight: 10-15 kDa GenBank Accession Number: BC113077 Gene Symbol: KRTAP3-1 Gene ID (NCBI): 83896 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYR8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.