Iright
BRAND / VENDOR: Proteintech

Proteintech, 21693-1-AP, TTC31 Polyclonal antibody

CATALOG NUMBER: 21693-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TTC31 (21693-1-AP) by Proteintech is a Polyclonal antibody targeting TTC31 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 21693-1-AP targets TTC31 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells Positive IHC detected in: human testis tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16281 Product name: Recombinant human TTC31 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-358 aa of BC098365 Sequence: MAPIPKTVGRIKLDCSLRPSCPLEVAAAPKLCKEFGPEDYGEEDIVDFLRRLVESDPQGLHRIHVDGSSGRLQLWHHDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQESEPCPQSPSASATFPSVSDSLLQVAMPQKLLVTEEEANRLAEELVAEEERMKQKAEKKRLKKKRQKERKRQERLEQYCGEPKASTTSDGDESPPSSPGNPVQGQCGEEEDSLDLSSTFVSLALRKVGDWPLSARREKGLNQEPQGRGLALQKMGQEEESPPREERPQQSPKEKDLGRLRPQDLLDFAPYPQASPGLLAAALQQSQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQDHR Predict reactive species Full Name: tetratricopeptide repeat domain 31 Calculated Molecular Weight: 358 aa, 40 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC098365 Gene Symbol: TTC31 Gene ID (NCBI): 64427 RRID: AB_11182824 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q49AM3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924