Product Description
Size: 20ul / 150ul
The PFKFB1 (21718-1-AP) by Proteintech is a Polyclonal antibody targeting PFKFB1 in WB, IHC, ELISA applications with reactivity to human samples
21718-1-AP targets PFKFB1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HepG2 cells, SMM-7721 cells
Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:100-1:400
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16362 Product name: Recombinant human PFKFB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-241 aa of BC096079 Sequence: ERRSLILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECYEVNYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTV Predict reactive species
Full Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1
Calculated Molecular Weight: 471 aa, 55 kDa
Observed Molecular Weight: 47 kDa
GenBank Accession Number: BC096079
Gene Symbol: PFKFB1
Gene ID (NCBI): 5207
RRID: AB_2878911
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P16118
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924