Proteintech, 21725-1-AP, Cytokeratin 2e Polyclonal antibody

Size: 20ul / 150ul The Cytokeratin 2e (21725-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 2e in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21725-1-AP targets Cytokeratin 2e in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse skin tissue, rat skin tissue. Positive IHC detected in: human cervical cancer tissue, human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18).Keratin 2 is a type II cytokeratin. It is found largely in the upper spinous layer of epidermal keratinocytes, and also in other regions, notably the epidermis covering the knee, thigh, and groin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16384 Product name: Recombinant human KRT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-331 aa of BC096294 Sequence: WELLQQMNVGTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDT Predict reactive species Full Name: keratin 2 Calculated Molecular Weight: 639 aa, 66 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC096294 Gene Symbol: KRT2 Gene ID (NCBI): 3849 RRID: AB_2878914 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35908 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.