Proteintech, 21726-1-AP, SLC15A1/PEPT1 Polyclonal antibody

Size: 20ul / 150ul The SLC15A1/PEPT1 (21726-1-AP) by Proteintech is a Polyclonal antibody targeting SLC15A1/PEPT1 in WB, ELISA applications with reactivity to human, mouse samples 21726-1-AP targets SLC15A1/PEPT1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, Caco-2 cells, HT-29 cells, MOLT-4 cells, mouse small intestine tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SLC15A1/PEPT1 is a peptide transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides. PEPT1 mediates transepithelial transport of muramyl and N-formylated bacterial dipeptides contributing to recognition of pathogenic bacteria by the mucosal immune system. PEPT1 is primarily expressed in the small intestine (PMID: 22194420). PEPT1 is also expressed in distal colon in rodents and humans and contributes to water absorption. 71 kDa nonglycosylated PEPT1 protein can be detected (PMID: 23660505). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16390 Product name: Recombinant human SLC15A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-580 aa of BC096327 Sequence: VAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVN Predict reactive species Full Name: solute carrier family 15 (oligopeptide transporter), member 1 Calculated Molecular Weight: 708 aa, 79 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC096327 Gene Symbol: SLC15A1/PEPT1 Gene ID (NCBI): 6564 RRID: AB_3085668 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46059 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.