Product Description
Size: 20ul / 150ul
The PURG (21750-1-AP) by Proteintech is a Polyclonal antibody targeting PURG in WB, ELISA applications with reactivity to human, mouse, rat samples
21750-1-AP targets PURG in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Hela cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
PURG (Purine-rich element-binding protein G) is a member of the PUR protein family. It has 2 isoforms with a molecular weight of 37-40 kDa.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag15820 Product name: Recombinant human PURG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-182 aa of BC106708 Sequence: HYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRK Predict reactive species
Full Name: purine-rich element binding protein G
Calculated Molecular Weight: 347 aa, 40 kDa
Observed Molecular Weight: 36-40 kDa
GenBank Accession Number: BC106708
Gene Symbol: PURG
Gene ID (NCBI): 29942
RRID: AB_3085669
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UJV8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924