Iright
BRAND / VENDOR: Proteintech

Proteintech, 21752-1-AP, ZNF750 Polyclonal antibody

CATALOG NUMBER: 21752-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF750 (21752-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF750 in IHC, IP, ELISA applications with reactivity to human samples 21752-1-AP targets ZNF750 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: SiHa cells Positive IHC detected in: human oesophagus cancer tissue, human skin tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ZNF750 is a novel nuclear protein highly expressed in differentiated skin keratinocytes. Mutation of ZNF750 is linked with familial psoriasis. Recently ZNF was found to be significantly mutated in esophageal squamous cell carcinoma (ESCC). Expression of ZNF750 is decreased in ESCC compared to the normal tissue. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16116 Product name: Recombinant human ZNF750 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-723 aa of BC109037 Sequence: HVEFESPIPEAKDSSKAGQRDTEGSKMSPRAGSAATGSPGRPSPTDFMQTSQTCEGLYDLSNKAASSALGRLYPPEQSLTAFRPVKKSTECLPAQAAETTAESPVSLNVVNGDPPAPTGSASLVSEAAPSSPDDSSGMGPLNLSKKSEINLAATHEPTYQGSPQAETASFSELQDLPLNLSVKDPCNTQAPRPAFPGRPRAAEPAAAVPQKTGTEGSEDGPSHPETKPGSLDGDGAPPTGPGEEAPDACAVDSSEEQKQTAAVALCQLAAYSPRNIRVGDGDAAAPEPACRQDTPTLSSMESQEAQCDLRPKGQKRTSLRDAGKSQQGAKKAKLQDTARVFTLRRRARVS Predict reactive species Full Name: zinc finger protein 750 Calculated Molecular Weight: 723 aa, 77 kDa Observed Molecular Weight: 70-77 kDa GenBank Accession Number: BC109037 Gene Symbol: ZNF750 Gene ID (NCBI): 79755 RRID: AB_10863125 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q32MQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924