Proteintech, 21754-1-AP, PDE4C Polyclonal antibody

Size: 20ul / 150ul The PDE4C (21754-1-AP) by Proteintech is a Polyclonal antibody targeting PDE4C in WB, ELISA applications with reactivity to human, mouse samples 21754-1-AP targets PDE4C in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information PDE4C(cAMP-specific 3,5-cyclic phosphodiesterase 4C) is also named as DPDE1 and belongs to the PDE4 subfamily, which play a key role in lung inflammation and hyperresponsiveness. PDE4C promotes the hydrolysis of cAMP, and PKD2, functioning as a Ca2+ entry channel, may mediate local accumulation of Ca2+ that inhibits the activity of Ca2+-sensitive ADCY5(PMID:21670265). The three isoforms(84,75, and 64 kDa) of PDE4C have been detected in cytosolic, microsomal, and nuclear (PMID:21784969). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16130 Product name: Recombinant human PDE4C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-91 aa of BC109067 Sequence: EYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQEEQLAK Predict reactive species Full Name: phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) Calculated Molecular Weight: 712 aa, 80 kDa Observed Molecular Weight: ~70 kDa GenBank Accession Number: BC109067 Gene Symbol: PDE4C Gene ID (NCBI): 5143 RRID: AB_10860265 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08493 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.