Proteintech, 21768-1-AP, FAM117B Polyclonal antibody

Size: 20ul / 150ul The FAM117B (21768-1-AP) by Proteintech is a Polyclonal antibody targeting FAM117B in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 21768-1-AP targets FAM117B in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, mouse kidney tissue, rat kidney tissue Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information FAM117B, also named as ALS2CR13, is mapped in the genomic region covering the complete candidate region for Amyotrophic lateral sclerosis 2 (ALS2). This antibody is specific to FAM117B. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16407 Product name: Recombinant human FAM117B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 49-128 aa of BC106906 Sequence: SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI Predict reactive species Full Name: family with sequence similarity 117, member B Calculated Molecular Weight: 589 aa, 62 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC106906 Gene Symbol: FAM117B Gene ID (NCBI): 150864 RRID: AB_10804757 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P1L5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.