Proteintech, 21771-1-AP, LCE1B Polyclonal antibody

Size: 20ul / 150ul The LCE1B (21771-1-AP) by Proteintech is a Polyclonal antibody targeting LCE1B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21771-1-AP targets LCE1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, mouse skin tissue, rat skin tissue Positive IHC detected in: human skin tissue, human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Human LCE1B (Late cornified envelope protein 1B), also named late envelope protein 2 (LEP2), is located at human Chromosome1q21 which contains multiple LCE clusters. LCE1B gene is predicated to encode a 118-aa protein, and is currently evidenced at transcript level. Its expression was skin-specific and was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue (PMID: 15854049). LCE genes respond to environmental stimuli such as calcium levels and ultraviolet (UV) light, however, LCE groups have distinct functions (PMID: 15854049). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16442 Product name: Recombinant human LCE1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC104232 Sequence: MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC Predict reactive species Full Name: late cornified envelope 1B Calculated Molecular Weight: 118 aa, 12 kDa Observed Molecular Weight: 10-12 kDa GenBank Accession Number: BC104232 Gene Symbol: LCE1B Gene ID (NCBI): 353132 RRID: AB_10858482 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T7P3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.