Iright
BRAND / VENDOR: Proteintech

Proteintech, 21803-1-AP, ID4 Polyclonal antibody

CATALOG NUMBER: 21803-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ID4 (21803-1-AP) by Proteintech is a Polyclonal antibody targeting ID4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21803-1-AP targets ID4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, MDA-MB-231 cells, mouse testis tissue Positive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ID4 (inhibitor of DNA binding 4) negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. (PMID: 19783986). ID4 levels dictate the stem cell state in mouse spermatogonia (PMID: 28087628). It is involved in the regulation of many cellular processes during both prenatal development and tumorigenesis. ID4 can be detected 25-30 kDa (PMID: 34108007, PMID: 31847356). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16883 Product name: Recombinant human ID4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC014941 Sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND Predict reactive species Full Name: inhibitor of DNA binding 4, dominant negative helix-loop-helix protein Calculated Molecular Weight: 161 aa, 17 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC014941 Gene Symbol: ID4 Gene ID (NCBI): 3400 RRID: AB_3085673 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P47928 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924