Iright
BRAND / VENDOR: Proteintech

Proteintech, 21836-1-AP, KBTBD5 Polyclonal antibody

CATALOG NUMBER: 21836-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KBTBD5 (21836-1-AP) by Proteintech is a Polyclonal antibody targeting KBTBD5 in WB, IHC, ELISA applications with reactivity to human, mouse samples 21836-1-AP targets KBTBD5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information KBTBD5, also known as KLHL40 and SRYP, contains a BACK domain, a BTB/POZ domain and 5 Kelch repeats. It is expressed predominantly in skeletal muscle. The KLHL40 gene mutation is responsible for a severe and potentially fatal neuromyopathy (PMID: 38397198). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16430 Product name: Recombinant human KBTBD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 312-621 aa of BC110491 Sequence: FGMFLQDLIFMISEEGAVAYDPAANECYCASLSSQVPKNHVSLVTKENQVFVAGGLFYNEDNKEDPMSAYFLQFDHLDSEWLGMPPLPSPRCLFGLGEALNSIYVVGGREIKDGERCLDSVMCYDRLSFKWGESDPLPYVVYGHTVLSHMDLVYVIGGKGSDRKCLNKMCVYDPKKFEWKELAPMQTARSLFGATVHDGRIIVAAGVTDTGLTSSAEVYSITDNKWAPFEAFPQERSSLSLVSLVGTLYAIGGFATLETESGELVPTELNDIWRYNEEEKKWEGVLREIAYAAGATFLPVRLNVLRLTKM Predict reactive species Full Name: kelch repeat and BTB (POZ) domain containing 5 Calculated Molecular Weight: 621 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC110491 Gene Symbol: KBTBD5 Gene ID (NCBI): 131377 RRID: AB_2878923 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2TBA0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924