Iright
BRAND / VENDOR: Proteintech

Proteintech, 21865-1-AP, IL-6 Polyclonal antibody

CATALOG NUMBER: 21865-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-6 (21865-1-AP) by Proteintech is a Polyclonal antibody targeting IL-6 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 21865-1-AP targets IL-6 in WB, IHC, IF/ICC, IP, Neutralization, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LPS and Protein transport inhibitor treated HUVEC cells Positive IP detected in: LPS and Protein transport inhibitor treated HUVEC cells Positive IF/ICC detected in: LPS and Brefeldin A treated HUVEC cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity. Specification Tested Reactivity: human Cited Reactivity: human, pig, rabbit, canine, bovine, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10565 Product name: Recombinant human IL-6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC015511 Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Predict reactive species Full Name: interleukin 6 (interferon, beta 2) Calculated Molecular Weight: 212 aa, 24 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC015511 Gene Symbol: IL6 Gene ID (NCBI): 3569 ENSEMBL Gene ID: ENSG00000136244 RRID: AB_11142677 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05231 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924