Proteintech, 21871-1-AP, SLC38A9 Polyclonal antibody

Size: 20ul / 150ul The SLC38A9 (21871-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A9 in WB, IF-P, ELISA applications with reactivity to Human, Mouse samples 21871-1-AP targets SLC38A9 in WB, IF-P, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: mouse pancreas tissue Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The mTOR complex 1 (mTORC1) protein kinase is a master growth regulator that responds to multiple environmental cues. The lysosomal amino acid transporter SLC38A9 is a physical and functional component of this sensing complex. SLC38A9 (Solute Carrier Family 38 Member 9) was first identified as a potential amino acid transporter belonging to the slc38 family. SLC38A9 has some isoforms: 64,53,57 kDa. Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16174 Product name: Recombinant human SLC38A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC101362 Sequence: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMM Predict reactive species Full Name: solute carrier family 38, member 9 Calculated Molecular Weight: 561 aa, 64 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC101362 Gene Symbol: SLC38A9 Gene ID (NCBI): 153129 RRID: AB_3085676 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NBW4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.