Product Description
Size: 20ul / 150ul
The ATAD3C (21881-1-AP) by Proteintech is a Polyclonal antibody targeting ATAD3C in WB, ELISA applications with reactivity to human samples
21881-1-AP targets ATAD3C in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
ATAD3 (ATPase family AAA Domain-containing protein 3) is a mitochondrial transmembrane protein involved in a variety of cellular processes. ATAD3 contains three isoforms: ATAD3A, ATAD3B and ATAD3C. ATAD3C has a negative dominant role in mitochondrial OXPHOS function and its expression regulates ATAD3A in cells (PMID: 38092275). This antibody can detect ATAD3C.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16422 Product name: Recombinant human ATAD3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC101211 Sequence: MPEDRTAGRVLAGHGVCLQGRGPDRGHDGRLRARLCPAAPADDALAEGGEAWARGRATLILSPWGDHTSRSLAADPSHPCLCGPAHLGNTPRNKVPRGPHRCVYWLTRGGVWGPLTSPWGQR Predict reactive species
Full Name: ATPase family, AAA domain containing 3C
Calculated Molecular Weight: 473 aa, 52 kDa
Observed Molecular Weight: 46 kDa
GenBank Accession Number: BC101211
Gene Symbol: ATAD3C
Gene ID (NCBI): 219293
RRID: AB_3669379
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q5T2N8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924