Iright
BRAND / VENDOR: Proteintech

Proteintech, 21909-1-AP, SHF Polyclonal antibody

CATALOG NUMBER: 21909-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SHF (21909-1-AP) by Proteintech is a Polyclonal antibody targeting SHF in WB, ELISA applications with reactivity to human, mouse, rat samples 21909-1-AP targets SHF in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15083 Product name: Recombinant human SHF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC101601 Sequence: MEPYEAQKMMAEIRGSKETATQPLPLYDTPYEPEEDGATPEGEGAPWPRESRLPEDDERPPEEYDQPWEWKKERISKAFAVDIKVIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDSSAQFEGPEKSCLSPGREEKGRLPPRLSAGNPKSAKPLSMEPSSPLGEWTDPALPLENQ Predict reactive species Full Name: Src homology 2 domain containing F Calculated Molecular Weight: 480 aa, 53 kDa Observed Molecular Weight: 46-50 kDa GenBank Accession Number: BC101601 Gene Symbol: SHF Gene ID (NCBI): 90525 RRID: AB_11182725 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: B3KTY1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924