Iright
BRAND / VENDOR: Proteintech

Proteintech, 21924-1-AP, VAV2 Polyclonal antibody

CATALOG NUMBER: 21924-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VAV2 (21924-1-AP) by Proteintech is a Polyclonal antibody targeting VAV2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21924-1-AP targets VAV2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue, A431 cells, NIH/3T3 cells, HeLa cells, mouse liver tissue, rat liver tissue, SH-SY5Y cells Positive IP detected in: HeLa cells Positive IHC detected in: human kidney tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16458 Product name: Recombinant human VAV2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 98-326 aa of BC132967 Sequence: DLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVV Predict reactive species Full Name: vav 2 guanine nucleotide exchange factor Calculated Molecular Weight: 839 aa, 97 kDa Observed Molecular Weight: 101 kDa GenBank Accession Number: BC132967 Gene Symbol: VAV2 Gene ID (NCBI): 7410 RRID: AB_11182283 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924