Iright
BRAND / VENDOR: Proteintech

Proteintech, 21966-1-AP, LMO2 Polyclonal antibody

CATALOG NUMBER: 21966-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LMO2 (21966-1-AP) by Proteintech is a Polyclonal antibody targeting LMO2 in WB, ELISA applications with reactivity to human, mouse samples 21966-1-AP targets LMO2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16795 Product name: Recombinant human LMO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC034041 Sequence: MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI Predict reactive species Full Name: LIM domain only 2 (rhombotin-like 1) Calculated Molecular Weight: 227 aa, 25 kDa Observed Molecular Weight: 17-25 kDa GenBank Accession Number: BC034041 Gene Symbol: LMO2 Gene ID (NCBI): 4005 RRID: AB_2878955 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25791 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924