Iright
BRAND / VENDOR: Proteintech

Proteintech, 21979-1-AP, DYRK2 Polyclonal antibody

CATALOG NUMBER: 21979-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DYRK2 (21979-1-AP) by Proteintech is a Polyclonal antibody targeting DYRK2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21979-1-AP targets DYRK2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, K-562 cells, mouse testis tissue, rat testis tissue Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DYRK (Dual-specificity tyrosine phosphorylation-regulated kinase 2) is the only member of the Dual-specificity tYrosine phosphorylation-Regulated Kinase (DYRK) family that functions as a kinase activity-independent scaffold for an E3 ubiquitin ligase complex (PMID: 33376136). DYRK2 is involved in cell survival, development, differentiation, gene transcription, proteasomal regulation, and microtubule formation. DYRK2 is a key regulator of cell cycle and apoptosis in response to DNA damage via phosphorylation of p53. DYRK2 has two isoforms and is mostly localized in the cytoplasm; however, it accumulates in the nucleus under genotoxic stress conditions (PMID: 31505048, 37886981). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13480 Product name: Recombinant human DYRK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC006375 Sequence: MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNAAAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT Predict reactive species Full Name: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 67~70 kDa GenBank Accession Number: BC006375 Gene Symbol: DYRK2 Gene ID (NCBI): 8445 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92630 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924