Iright
BRAND / VENDOR: Proteintech

Proteintech, 21987-1-AP, TSPAN31 Polyclonal antibody

CATALOG NUMBER: 21987-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSPAN31 (21987-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN31 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21987-1-AP targets TSPAN31 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat heart tissue, HeLa cells, HepG2 cells, mouse skeletal muscle tissue, PC-3 cells Positive IHC detected in: human skeletal muscle tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Tetraspanin-31 (TSPAN31) belongs to the tetraspanin (TM4SF) family, also known as the transmembrane 4 (TM4) superfamily, which is a family of transmembrane proteins with 33 mammalian members. These proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth, and motility. Tetraspanin-31 is thought to be involved in growth-related cellular processes. The experimentally determined molecular mass of 30 kDa is larger than the calculated molecular mass of 23 kDa, which could be a result of post-translational modifications. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17138 Product name: Recombinant human TSPAN31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-180 aa of BC010377 Sequence: VISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGL Predict reactive species Full Name: tetraspanin 31 Calculated Molecular Weight: 210 aa, 23 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC010377 Gene Symbol: TSPAN31 Gene ID (NCBI): 6302 RRID: AB_2878962 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12999 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924