Iright
BRAND / VENDOR: Proteintech

Proteintech, 22001-1-AP, STRA6 Polyclonal antibody

CATALOG NUMBER: 22001-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STRA6 (22001-1-AP) by Proteintech is a Polyclonal antibody targeting STRA6 in WB, ELISA applications with reactivity to human, mouse samples 22001-1-AP targets STRA6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information STRA6, also known as MCOPS9 and PP14296. Functions as retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1. Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin. (PMID:9452451; 18316031; 22665496; 21368206; 22665496). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17591 Product name: Recombinant human STRA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 527-667 aa of BC025256 Sequence: MVATWRVLLSALYNAIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP Predict reactive species Full Name: stimulated by retinoic acid gene 6 homolog (mouse) Calculated Molecular Weight: 667 aa, 74 kDa Observed Molecular Weight: 73-78 kDa GenBank Accession Number: BC025256 Gene Symbol: STRA6 Gene ID (NCBI): 64220 RRID: AB_11064606 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BX79 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924