Product Description
Size: 20ul / 150ul
The CALHM1 (22042-1-AP) by Proteintech is a Polyclonal antibody targeting CALHM1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
22042-1-AP targets CALHM1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Background Information
Calcium homeostasis modulator 1 (CALHM1) is a membrane protein with four transmembrane helices that form an octameric ion channel with voltage-dependent activation.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14938 Product name: Recombinant human CALHM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-346 aa of BC036193 Sequence: CTEHAKAFAKVCIQQFFEAMNHDLELGHTNGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV Predict reactive species
Full Name: calcium homeostasis modulator 1
Calculated Molecular Weight: 346 aa, 38 kDa
Observed Molecular Weight: 38-40 kDa
GenBank Accession Number: BC036193
Gene Symbol: CALHM1
Gene ID (NCBI): 255022
RRID: AB_11182709
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8IU99
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924