Iright
BRAND / VENDOR: Proteintech

Proteintech, 22051-1-AP, FOXP1 Polyclonal antibody

CATALOG NUMBER: 22051-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FOXP1 (22051-1-AP) by Proteintech is a Polyclonal antibody targeting FOXP1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 22051-1-AP targets FOXP1 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, A549 cells, LNCaP cells, MCF-7 cells, MDA-MB-453s cells, mouse heart tissue, mouse lung tissue, mouse testis tissue, PC-3 cells, Raji cells, Y79 cells Positive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information FOXP1, also known as Mac-1-regulated forkhead, is a 677 amino acid protein, which forms homodimers and heterodimers with FOXP2 and FOXP4 (PubMed:25027557). Dimerization is required for DNA-binding. FOXP1 has an important function in neuronal development.9 Mutations of its gene, FOXP1, located on chromosome 3p14.1,7 can result in the development of autism spectrum disorder, intellectual disability, speech and language deficits as well as motor development delay. FOXP1 is also engaged in lung and esophagus morphogenesis, as well as in B-cell development.7,10 The widely researched role of FOXP1 in carcinogenesis is of great importance, although still unclear to some extent. FOXP1 exists some isoforms with MV 75-77 kDa, 65-67 kDa, 12 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17045 Product name: Recombinant human FOXP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 349-457 aa of BC131720 Sequence: QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEF Predict reactive species Full Name: forkhead box P1 Calculated Molecular Weight: 677 aa, 75 kDa Observed Molecular Weight: 50 kDa, 60-65 kDa, 85 kDa GenBank Accession Number: BC131720 Gene Symbol: FOXP1 Gene ID (NCBI): 27086 RRID: AB_2878980 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H334 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924