Iright
BRAND / VENDOR: Proteintech

Proteintech, 22067-1-AP, CDK8 Polyclonal antibody

CATALOG NUMBER: 22067-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDK8 (22067-1-AP) by Proteintech is a Polyclonal antibody targeting CDK8 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 22067-1-AP targets CDK8 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells, mouse embryo tissue Positive IHC detected in: human stomach cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Positive FC (Intra) detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17148 Product name: Recombinant human CDK8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 360-464 aa of BC069634 Sequence: TEEEPDDKGDKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY Predict reactive species Full Name: cyclin-dependent kinase 8 Calculated Molecular Weight: 464 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC069634 Gene Symbol: CDK8 Gene ID (NCBI): 1024 RRID: AB_2878983 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49336 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924