Iright
BRAND / VENDOR: Proteintech

Proteintech, 22074-1-AP, ZNF718 Polyclonal antibody

CATALOG NUMBER: 22074-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF718 (22074-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF718 in IF/ICC, ELISA applications with reactivity to human samples 22074-1-AP targets ZNF718 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17216 Product name: Recombinant human ZNF718 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 311-431 aa of BC104027 Sequence: FSCEECGNVFTTSSDFAKHKRIHTGEKPYKCEECGKSFNRSTTLTTHKRIHTGEKPYTCEECGKAFNWSSTLNVHKRIHSGKNPYKCEDCGKAFKVFANLHNHKKIHTGEKPYICKQCGKA Predict reactive species Full Name: zinc finger protein 718 Calculated Molecular Weight: 478 aa, 55 kDa GenBank Accession Number: BC104027 Gene Symbol: ZNF718 Gene ID (NCBI): 255403 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3SXZ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924