Iright
BRAND / VENDOR: Proteintech

Proteintech, 22081-1-AP, FOXD4L6 Polyclonal antibody

CATALOG NUMBER: 22081-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FOXD4L6 (22081-1-AP) by Proteintech is a Polyclonal antibody targeting FOXD4L6 in WB, ELISA applications with reactivity to human samples 22081-1-AP targets FOXD4L6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Forkhead box protein D4-like 6(FOXD4L6)also named as FOXD4 like 6 is a 417 amino acid protein, which contains one fork head DNA-binding domain. FOXD4L6 localizes in the nucleus. The molecular weight of FOXD4L6 is 46kDa, but our experiment always detected a 60-70kDa protein by western blot. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17247 Product name: Recombinant human FOXD4L6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 208-417 aa of BC103887 Sequence: QLTPGAHLPHPFPLPAAHAALHNPHPGPLLGAPAPPQPVPGAYPNTAPGRRPYALLHPHPLRYLLLSAPVYAGAPKKAEGAALATPAPFPCCSPHLVLSLGRRARVWRRHREADASLSALRVLCKGSGERVQGLRRVCPRPRGATATCSSDHQACCIPRPLPLCCKCPPPPLLGQFCSNSSSIRRRTAPTAALPPRARCWAGTCRPRRRC Predict reactive species Full Name: forkhead box D4-like 6 Calculated Molecular Weight: 417 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC103887 Gene Symbol: FOXD4L6 Gene ID (NCBI): 653404 RRID: AB_2878988 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3SYB3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924