Proteintech, 22088-1-AP, DULLARD Polyclonal antibody

Size: 20ul / 150ul The DULLARD (22088-1-AP) by Proteintech is a Polyclonal antibody targeting DULLARD in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 22088-1-AP targets DULLARD in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, mouse skeletal muscle tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17288 Product name: Recombinant human DULLARD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-244 aa of BC009295 Sequence: MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW Predict reactive species Full Name: dullard homolog (Xenopus laevis) Calculated Molecular Weight: 244 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC009295 Gene Symbol: DULLARD Gene ID (NCBI): 23399 RRID: AB_2878991 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95476 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.