Product Description
Size: 20ul / 150ul
The ALDH1A1-specific (22109-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH1A1-specific in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
22109-1-AP targets ALDH1A1-specific in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: A549 cells, human liver tissue, K-562 cells, HepG2 cells, mouse liver tissue
Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
ALDH1A1(Aldehyde dehydrogenase family 1 member A1 ), also named as ALDC, ALDH1 and PUMB1, belongs to the aldehyde dehydrogenase family. The ALDH1A1 gene encodes a liver cytosolic isoform of acetaldehyde dehydrogenase, an enzyme involved in the major pathway of alcohol metabolism after alcohol dehydrogenase. ALDH1A1 plays a critical role in protection against oxidative stress-induced cytotoxicity in lens epithelial cells(PMID:19296407). And it is important for multiple biological activities including drug resistance, cell differentiation, and oxidative stress response(PMID:19025616). As a novel cancer stem cell marker, ALDH1A1 can be used for tumors whose corresponding normal tissues express ALDH1 in relatively restricted or limited levels such as breast, lung, ovarian or colon cancer(PMID: 20422001). This antibody can also recognize some other membranes of the aldehyde dehydrogenase family. This antibody is specific to ALDH1A1.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag17358 Product name: Recombinant human ALDH1A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 403-449 aa of BC001505 Sequence: GPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQA Predict reactive species
Full Name: aldehyde dehydrogenase 1 family, member A1
Calculated Molecular Weight: 501 aa, 55 kDa
Observed Molecular Weight: 55 kDa
GenBank Accession Number: BC001505
Gene Symbol: ALDH1A1
Gene ID (NCBI): 216
RRID: AB_10949189
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P00352
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924