Product Description
Size: 20ul / 150ul
The Ubiquilin 1 (22126-1-AP) by Proteintech is a Polyclonal antibody targeting Ubiquilin 1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
22126-1-AP targets Ubiquilin 1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: T-47D cells, Transfected HEK-293 cells, mouse brain tissue, rat brain tissue
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
UBQLN1, also known as DSK2 or Ubiquilin 1, is an ubiquitin-like proteinis contains a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.Ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene. Higher levels of ubiquilin-1 in the brain decreased malformation of the APP molecule which plays a key role in triggering Alzheimers disease.Conversely, lower levels of ubiquilin-1 in the brain were associated with increased malformation of APP (PMID: 21852239). This antibody detects 70kD band of UBQLN1.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag17530 Product name: Recombinant human Ubiquilin 1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 324-376 aa of BC010066 Sequence: WAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPG Predict reactive species
Full Name: ubiquilin 1
Calculated Molecular Weight: 589 aa, 63 kDa
Observed Molecular Weight: 63-71 kDa
GenBank Accession Number: BC010066
Gene Symbol: Ubiquilin 1
Gene ID (NCBI): 29979
RRID: AB_2879000
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UMX0
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924