Iright
BRAND / VENDOR: Proteintech

Proteintech, 22126-1-AP, Ubiquilin 1 Polyclonal antibody

CATALOG NUMBER: 22126-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Ubiquilin 1 (22126-1-AP) by Proteintech is a Polyclonal antibody targeting Ubiquilin 1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 22126-1-AP targets Ubiquilin 1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: T-47D cells, Transfected HEK-293 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information UBQLN1, also known as DSK2 or Ubiquilin 1, is an ubiquitin-like proteinis contains a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.Ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene. Higher levels of ubiquilin-1 in the brain decreased malformation of the APP molecule which plays a key role in triggering Alzheimers disease.Conversely, lower levels of ubiquilin-1 in the brain were associated with increased malformation of APP (PMID: 21852239). This antibody detects 70kD band of UBQLN1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17530 Product name: Recombinant human Ubiquilin 1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 324-376 aa of BC010066 Sequence: WAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPG Predict reactive species Full Name: ubiquilin 1 Calculated Molecular Weight: 589 aa, 63 kDa Observed Molecular Weight: 63-71 kDa GenBank Accession Number: BC010066 Gene Symbol: Ubiquilin 1 Gene ID (NCBI): 29979 RRID: AB_2879000 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UMX0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924