Proteintech, 22150-1-AP, PYCR1 Polyclonal antibody

Size: 20ul / 150ul The PYCR1 (22150-1-AP) by Proteintech is a Polyclonal antibody targeting PYCR1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 22150-1-AP targets PYCR1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, COLO 320 cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PYCR1,also named as P5CR1, belongs to the pyrroline-5-carboxylate reductase family. It is a housekeeping enzyme that catalyzes the last step in proline biosynthesis. PYCR1 can utilize both NAD and NADP, but has higher affinity for NAD. It is involved in the cellular response to oxidative stress. Mutation in PYCR1 will cause ARCL type II(ARCL2B ). Some mutation will cause DeBarsy syndrome (DBS) which is characterized by progeroid features, ophthalmological abnormalities, intrauterine growth retardation, and cutis laxa. The MW of PYCR1 is about 33-35kd. This antibody may have cross reaction to PYCR2 due to the high homology. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17745 Product name: Recombinant human PYCR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-148 aa of BC022244 Sequence: ALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRL Predict reactive species Full Name: pyrroline-5-carboxylate reductase 1 Calculated Molecular Weight: 319 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC022244 Gene Symbol: PYCR1 Gene ID (NCBI): 5831 RRID: AB_11182280 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P32322 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.