Proteintech, 22165-1-AP, LPAR4 Polyclonal antibody

Size: 20ul / 150ul The LPAR4 (22165-1-AP) by Proteintech is a Polyclonal antibody targeting LPAR4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 22165-1-AP targets LPAR4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, mouse brain tissue, HL-60 cells, 3T3-L1 cells Positive IHC detected in: human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SW 1990 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17817 Product name: Recombinant human LPAR4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 311-370 aa of BC069996 Sequence: YYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF Predict reactive species Full Name: lysophosphatidic acid receptor 4 Calculated Molecular Weight: 370 aa, 42 kDa Observed Molecular Weight: 42-50 kDa GenBank Accession Number: BC069996 Gene Symbol: LPAR4 Gene ID (NCBI): 2846 RRID: AB_11182491 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99677 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.