Proteintech, 22185-1-AP, SS18 Polyclonal antibody

Size: 20ul / 150ul The SS18 (22185-1-AP) by Proteintech is a Polyclonal antibody targeting SS18 in WB, IHC, ELISA applications with reactivity to human, mouse samples 22185-1-AP targets SS18 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16743 Product name: Recombinant human SS18 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 101-281 aa of BC096222 Sequence: SHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQG Predict reactive species Full Name: synovial sarcoma translocation, chromosome 18 Calculated Molecular Weight: 418 aa, 46 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC096222 Gene Symbol: SS18 Gene ID (NCBI): 6760 RRID: AB_3669390 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15532 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.