Iright
BRAND / VENDOR: Proteintech

Proteintech, 22197-1-AP, SHISA4 Polyclonal antibody

CATALOG NUMBER: 22197-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SHISA4 (22197-1-AP) by Proteintech is a Polyclonal antibody targeting SHISA4 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 22197-1-AP targets SHISA4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17357 Product name: Recombinant human SHISA4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 28-197 aa of BC104444 Sequence: GEDCLWYLDRNGSWHPGFNCEFFTFCCGTCYHRYCCRDLTLLITERQQKHCLAFSPKTIAGIASAVILFVAVVATTICCFLCSCCYLYRRRQQLQSPFEGQEIPMTGIPVQPVYPYPQDPKAGPAPPQPGFIYPPSGPAPQYPLYPAGPPVYNPAAPPPYMPPQPSYPGA Predict reactive species Full Name: shisa homolog 4 (Xenopus laevis) Calculated Molecular Weight: 197 aa, 22 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: BC104444 Gene Symbol: SHISA4 Gene ID (NCBI): 149345 RRID: AB_2879024 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q96DD7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924