Proteintech, 22201-1-AP, CNGA4 Polyclonal antibody

Size: 20ul / 150ul The CNGA4 (22201-1-AP) by Proteintech is a Polyclonal antibody targeting CNGA4 in WB, ELISA applications with reactivity to mouse, rat samples 22201-1-AP targets CNGA4 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CNGA4 (cyclic nucleotide gated channel subunit alpha 4), also known as CNG4. It is expected to be located in cell membrane. Cyclic nucleotide-gated (CNG) channels are crucial for visual and olfactory transductions (PMID: 12432397). Native CNG channels are heterotetramers composed of homologous A and B subunits. Olfactory CNG channels are composed of three types of subunits, CNGA2, CNGA4, and CNGB1b (PMID: 15134638). CNGA4 is a modulatory subunit which contributes to the high cAMP sensitivity of the native olfactory channel. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation of native olfactory neurons to odorants (PMID: 11739959; 11739960). The molecular weight of CNGA4 is 65 kDa, and it can recognize the 48 kDa isoform. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17481 Product name: Recombinant human CNGA4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 260-394 aa of BC106936 Sequence: TIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRKLERRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEELVLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLA Predict reactive species Full Name: cyclic nucleotide gated channel alpha 4 Calculated Molecular Weight: 575 aa, 66 kDa Observed Molecular Weight: 47-50 kDa, 65-70 kDa GenBank Accession Number: BC106936 Gene Symbol: CNGA4 Gene ID (NCBI): 1262 RRID: AB_3669391 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IV77 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.