Iright
BRAND / VENDOR: Proteintech

Proteintech, 22208-1-AP, Cytokeratin 7 Polyclonal antibody

CATALOG NUMBER: 22208-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Cytokeratin 7 (22208-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 7 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 22208-1-AP targets Cytokeratin 7 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, HepG2 cells Positive IHC detected in: human lung cancer tissue, human bowen disease, human breast cancer tissue, human kidney tissue, human ovary cancer tissue, human ovary tumor tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Positive IF/ICC detected in: A549 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17528 Product name: Recombinant human KRT7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC002700 Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQ Predict reactive species Full Name: keratin 7 Calculated Molecular Weight: 469 aa, 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC002700 Gene Symbol: Cytokeratin 7 Gene ID (NCBI): 3855 RRID: AB_2879030 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08729 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924