Product Description
Size: 20ul / 150ul
The Cytokeratin 7 (22208-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 7 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples
22208-1-AP targets Cytokeratin 7 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A431 cells, HeLa cells, HepG2 cells
Positive IHC detected in: human lung cancer tissue, human bowen disease, human breast cancer tissue, human kidney tissue, human ovary cancer tissue, human ovary tumor tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse liver tissue
Positive IF/ICC detected in: A549 cells, HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:400-1:1600
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag17528 Product name: Recombinant human KRT7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC002700 Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQ Predict reactive species
Full Name: keratin 7
Calculated Molecular Weight: 469 aa, 51 kDa
Observed Molecular Weight: 51 kDa
GenBank Accession Number: BC002700
Gene Symbol: Cytokeratin 7
Gene ID (NCBI): 3855
RRID: AB_2879030
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P08729
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924